General Information

  • ID:  hor003044
  • Uniprot ID:  Q8K4P2(22-50)
  • Protein name:  Neuropeptide B-29
  • Gene name:  NPB
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Neuropeptide B/W family
  • Source:  animal
  • Expression:  Detected in a variety of tissues. High levels are found in the lymphoid organs, central nervous system, mammary gland and uterus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WYKPAAGSHHYSVGRAAGLLSSFHRFPST
  • Length:  29(22-50)
  • Propeptide:  MVRCRTLVAAALALLLTPALAWYKPAAGSHHYSVGRAAGLLSSFHRFPSTRRSESPALRVGTVPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHKAECQSA
  • Signal peptide:  MVRCRTLVAAALALLLTPALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npbwr1
  • Target Unid:  Q56UD9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q1ECR9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q1ECR9-F1.pdbhor003044_AF2.pdbhor003044_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 368815 Formula: C147H211N43O38
Absent amino acids: CDEIMNQ Common amino acids: S
pI: 10.65 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -36.21 Boman Index: -3699
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 50.69
Instability Index: 4584.48 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  NA
  • Title:  NA