HORDB

ID: hor003044
Uniprot ID: Q8K4P2
Protein name: Neuropeptide B-29
Gene name: NPB
Organism: Rattus norvegicus (Rat)
Family: Neuropeptide B/W family
Source: animal
Expression: Detected in a variety of tissues. High levels are found in the lymphoid organs, central nervous system, mammary gland and uterus.
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
GO CC: GO:0005576 extracellular region

Sequence: WYKPAAGSHHYSVGRAAGLLSSFHRFPST
Length: 29
Propeptide: MVRCRTLVAAALALLLTPALAWYKPAAGSHHYSVGRAAGLLSSFHRFPSTRRSESPALRVGTVPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHKAECQSA
Signal peptide: MVRCRTLVAAALALLLTPALA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway
Mechanism: NA
Cross BBB: NA
Target: Npbwr1
Target Unid: Q56UD9
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q1ECR9-F1.pdb

hor003044_AF2.pdb

hor003044_ESM.pdb

Mass:	368815	Formula:	C147H211N43O38
Absent amino acids:	CDEIMNQ	Common amino acids:	S
pI:	10.65	Basic residues:	6
Polar residues:	11	Hydrophobic residues:	10
Hydrophobicity:	-36.21	Boman Index:	-3699
Half-Life:	2.8 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	50.69
Instability Index:	4584.48	Extinction Coefficient cystines:	8480
Absorbance 280nm:	302.86